Protein Info for LRK53_RS02340 in Rhodanobacter sp000427505 FW510-R12

Annotation: isopentenyl-diphosphate Delta-isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02150: isopentenyl-diphosphate delta-isomerase
  • amino acids 18 to 174 (157 residues), 151 bits, E=1.3e-48
• PF00293: NUDIX
  • amino acids 43 to 172 (130 residues), 65.9 bits, E=1.9e-22

Best Hits

Swiss-Prot: 42% identical to IDI_BURM1: Isopentenyl-diphosphate Delta-isomerase (idi) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: K01823, isopentenyl-diphosphate delta-isomerase [EC: 5.3.3.2] (inferred from 60% identity to avn:Avin_20640)

Predicted SEED Role

"Isopentenyl-diphosphate delta-isomerase (EC 5.3.3.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis or polyprenyl synthesis (EC 5.3.3.2)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (11/12 steps found)
• superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (9/10 steps found)
• taxadiene biosynthesis (engineered) (11/13 steps found)
• methylerythritol phosphate pathway I (8/9 steps found)
• mevalonate pathway I (eukaryotes and bacteria) (6/7 steps found)
• isoprene biosynthesis I (8/10 steps found)
• isoprene biosynthesis II (engineered) (6/8 steps found)
• all-trans-farnesol biosynthesis (3/4 steps found)
• mevalonate pathway II (haloarchaea) (4/7 steps found)
• bisabolene biosynthesis (engineered) (3/6 steps found)
• mono-trans, poly-cis decaprenyl phosphate biosynthesis (2/5 steps found)
• mevalonate pathway IV (archaea) (4/8 steps found)
• mevalonate pathway III (Thermoplasma) (3/8 steps found)
• superpathway of ergosterol biosynthesis II (10/26 steps found)
• superpathway of ergosterol biosynthesis I (8/26 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)
• superpathway of cholesterol biosynthesis (8/38 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.3.2

Protein Sequence (195 amino acids)

>LRK53_RS02340 isopentenyl-diphosphate Delta-isomerase (Rhodanobacter sp000427505 FW510-R12)
MADASLRHPTVSSEAEQLILVDADDRTVGYASKAAAHDGRGQRHRAFSLFIFNGHGELLL
QQRSRGKRLWPGYWANSCCSHPRRGESMEQATERRLQQELGMRCPLRYLFKFEYQADYRG
LGAEHELCWVYAGTCTQPVRANATEVEAWRFVAPAALDREIARDPERFTPWLKLEWAQLR
RDPALSACLSPPAGG