Protein Info for LRK53_RS02170 in Rhodanobacter sp000427505 FW510-R12

Annotation: F0F1 ATP synthase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details PF00137: ATP-synt_C" amino acids 16 to 78 (63 residues), 47 bits, see alignment E=1.2e-16 TIGR01260: ATP synthase F0, C subunit" amino acids 26 to 80 (55 residues), 69.5 bits, see alignment E=9.9e-24

Best Hits

Swiss-Prot: 75% identical to ATPL_POLSJ: ATP synthase subunit c (atpE) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 73% identity to bgl:bglu_1g00720)

Predicted SEED Role

"ATP synthase F0 sector subunit c"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (92 amino acids)

>LRK53_RS02170 F0F1 ATP synthase subunit C (Rhodanobacter sp000427505 FW510-R12)
MELITHIAQVQSFTAIALGLIIGLGALGACIGIGVMGSKFLEAAARQPELVPLLQGRMFL
LAGLIDAAFLIGVALAMYFAVANPLLSKLAGA