Protein Info for LRK53_RS02165 in Rhodanobacter sp000427505 FW510-R12

Annotation: F0F1 ATP synthase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 30 to 267 (238 residues), 142.1 bits, see alignment E=1.3e-45 PF00119: ATP-synt_A" amino acids 39 to 266 (228 residues), 198.3 bits, see alignment E=7.6e-63

Best Hits

Swiss-Prot: 52% identical to ATP6_NITEU: ATP synthase subunit a (atpB) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 54% identity to net:Neut_0271)

Predicted SEED Role

"ATP synthase F0 sector subunit a"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>LRK53_RS02165 F0F1 ATP synthase subunit A (Rhodanobacter sp000427505 FW510-R12)
MASEPTGGLTEYIQHHLQHLTPHASKEGFWAVHVDSVTVSLVLGVLFCLWFWLKARKATA
GVPGKGQAFVEIVLEFVDGQVKDVFHGDRRVLGPLALTVFVWVFLMNAMDLLPVDLLPWI
TEKFGIGHFRAVPTADINMTFAMSLTVFVLIIFYSFKAKGAGGYMHELFTAPFGKHPLLW
IPNFLLNMVELASKPVSLAMRLFGNMYAGELVFMLIAGLFSAGAGLAGWALYGAGIIGYT
VWGIFHILIISIQAFIFMVLTIVYISMAHDHH