Protein Info for LRK53_RS01930 in Rhodanobacter sp000427505 FW510-R12

Annotation: NAD(+) diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 243 to 259 (17 residues), see Phobius details PF09296: NUDIX-like" amino acids 50 to 138 (89 residues), 27.2 bits, see alignment E=5.6e-10 PF00293: NUDIX" amino acids 176 to 280 (105 residues), 71.8 bits, see alignment E=5.8e-24

Best Hits

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>LRK53_RS01930 NAD(+) diphosphatase (Rhodanobacter sp000427505 FW510-R12)
MDRAAQPPLNTFSGLSLVLDRVAELRDESAWIVEQARSPQARYLLLDGAGEAFLHRDRDA
LRWLDANEREQWLGDLRASLLGMAYERPHFLLVADDPARMGELEHALDARRMSLRGAGLQ
LAADEASLFAYAKGLSHWQRETRFCTHCGAPLLLVAAGHRAQCTNAECARLHFPRTDAAV
IMLVEHDGACLLGRQAGWPPGRYSTLAGFVEPGEALEDAVRREVAEEAGVIVDQVRYHSS
QPWPMPASLMVGFIATAVSRQIRMRDHELEDARWFTPAQIVDGIADGSFLPSTRLSVSYQ
LLAHWLRQRAGLELDALTAATPG