Protein Info for LRK53_RS01895 in Rhodanobacter sp000427505 FW510-R12

Annotation: glycine--tRNA ligase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 5 to 294 (290 residues), 529.7 bits, see alignment E=9e-164 PF02091: tRNA-synt_2e" amino acids 6 to 287 (282 residues), 496.4 bits, see alignment E=1.1e-153

Best Hits

Swiss-Prot: 85% identical to SYGA_XANCP: Glycine--tRNA ligase alpha subunit (glyQ) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 84% identity to psu:Psesu_2962)

MetaCyc: 76% identical to glycine--tRNA ligase subunit alpha (Escherichia coli K-12 substr. MG1655)
Glycine--tRNA ligase. [EC: 6.1.1.14]

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>LRK53_RS01895 glycine--tRNA ligase subunit alpha (Rhodanobacter sp000427505 FW510-R12)
MSARTFQDVIQTLNRYWAAQGCVLLQPLDTEVGAGTFHPATFLRALGPEPWAAAYVQPSR
RPTDGRYGENPNRLQHYYQYQVVMKPNPENILDLYIDSLKELGLDPLVHDLRFVEDNWES
PTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECRPVTGEITYGLERLAMYLQNVDNVYDL
VWTEGPYGTVTYGDVYHQNEVEQSTYNFEHANVPELLHWFDVCEATANQLVAANLPLPAY
EQVMKASHTFNLLDARRAISVTERQRYILRVRTLSRSVAETYVAQREKLGFPGLRNVFRE
RAA