Protein Info for LRK53_RS01890 in Rhodanobacter sp000427505 FW510-R12

Annotation: GspE/PulE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 PF05157: MshEN" amino acids 88 to 175 (88 residues), 58.7 bits, see alignment E=4.9e-20 PF00437: T2SSE" amino acids 210 to 592 (383 residues), 423.6 bits, see alignment E=5.4e-131

Best Hits

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 62% identity to xal:XALc_0077)

Predicted SEED Role

"Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>LRK53_RS01890 GspE/PulE family protein (Rhodanobacter sp000427505 FW510-R12)
MAASPQIASLLGRRGRLGLDELLATLVVDGYLLADDAKQVRMGVPAGRSTVELHPLVLIA
NARLANQHDPGRPLSLEGLTEWLAGHAGLPYLKIDPMKINVAAATQVVSHAYAKRHRILP
IAAAPGEVTFATCEPFEAGWAPDLAQMLRRDVKRVVASPIDINRYLQEFYGVQRSIQLAQ
DAKSGGDTSSAILNFEQLVELGKSGEVGADDRHVVHIVDWLLQYAFEQRASDIHLEPRRE
TGHIRFRIDGAMQKVFELPSPVMTAVTARIKILARMDVAEKRRPQDGRIKTRSSGGREVE
LRISNMPTAFGEKVVMRIFDPDLVVKDFAQLGFSANEAAHWRGMVERPHGIVLVTGPTGS
GKTTTLYSTLKHLATPELNVCTVEDPIEMVSPEFNQMQVHAAIELDFAAGVRTLLRQDPD
IIMIGEIRDLETAQVAVQASLTGHLVLSTLHTNDAPSAVTRLLDLGVPHYLIQSTLTGVV
AQRLVRTLCPHCKQVARQDPQAWTVLTHGWDVPVPPQVFQPVGCLECRHTGFLGRTGIYE
MLKLSPRLRGMVSAQLDLGRFGQAALSEGMRPLRISAADQVAAGLTTAQEVLTVLPPIDA
LDDAQP