Protein Info for LRK53_RS01840 in Rhodanobacter sp000427505 FW510-R12

Annotation: thiamine phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02581: TMP-TENI
  • amino acids 13 to 190 (178 residues), 169.2 bits, E=3.1e-54
• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 13 to 202 (190 residues), 178.6 bits, E=4.3e-57

Best Hits

Swiss-Prot: 54% identical to THIE_CHRVO: Thiamine-phosphate synthase (thiE) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 57% identity to hna:Hneap_1240)

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Protein Sequence (215 amino acids)

>LRK53_RS01840 thiamine phosphate synthase (Rhodanobacter sp000427505 FW510-R12)
MKKTPILSADRGLYAITDGPRDDLLAVVAQALAGGARLLQYRDLSDDAARRHAEATALMQ
LCRTHHVPLIIDHDIALAQAVGADGVHLGKDDDDPAAVRAVLGEHAIVGVSCYGSLPRAQ
AAARAGASYVSFGAFFPSPTKPLAARVPIDLLRQSAALGVPRVAIGGITPDNGASLVEAG
ADYLAAITAVFAAPDVRAAAQHFADLYPSDREPSR