Protein Info for LRK53_RS01840 in Rhodanobacter sp000427505 FW510-R12
Annotation: thiamine phosphate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to THIE_CHRVO: Thiamine-phosphate synthase (thiE) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 57% identity to hna:Hneap_1240)Predicted SEED Role
"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
- thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
- thiamine diphosphate salvage II (4/5 steps found)
- thiamine diphosphate salvage V (2/3 steps found)
- superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
- thiamine diphosphate biosynthesis III (Staphylococcus) (1/3 steps found)
- thiamine diphosphate biosynthesis IV (eukaryotes) (1/3 steps found)
- superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
- thiamine diphosphate salvage IV (yeast) (3/7 steps found)
- thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.3
Use Curated BLAST to search for 2.5.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (215 amino acids)
>LRK53_RS01840 thiamine phosphate synthase (Rhodanobacter sp000427505 FW510-R12) MKKTPILSADRGLYAITDGPRDDLLAVVAQALAGGARLLQYRDLSDDAARRHAEATALMQ LCRTHHVPLIIDHDIALAQAVGADGVHLGKDDDDPAAVRAVLGEHAIVGVSCYGSLPRAQ AAARAGASYVSFGAFFPSPTKPLAARVPIDLLRQSAALGVPRVAIGGITPDNGASLVEAG ADYLAAITAVFAAPDVRAAAQHFADLYPSDREPSR