Protein Info for LRK53_RS01760 in Rhodanobacter sp000427505 FW510-R12

Annotation: DUF2333 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details PF10095: DUF2333" amino acids 14 to 340 (327 residues), 437.4 bits, see alignment E=1.6e-135

Best Hits

KEGG orthology group: None (inferred from 53% identity to mme:Marme_3084)

Predicted SEED Role

"FIG014328: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>LRK53_RS01760 DUF2333 family protein (Rhodanobacter sp000427505 FW510-R12)
MQTPDISNSSRHGIRRAILALLALLVLGVAALMWWWDTEPALFDPAAATQAQLQELKRPV
STGATTTATLIASVRTLLDKRGGYLSNDKLPPGVLLDNIPNWEFGSLTASRDLVRALRND
FSRSQTQSTEDKDLAEADPLLNSPNDRWLLPSSESQYRKAIKHLEGYLARLGDSETSGAH
FYARADNLADYLQLASARLGSLSQRLSASVGQIRIGEVAGADQPAAAGTVAAPGGGRLVK
TPWTKIDDNFYEARGYTWTLLEQLKAFRQDFGPILRSKHADVSLEQVIRELEEAQRPLHS
PMVLNGSPFGFFANHSLVMANYVSRANAALIDLRELLRRG