Protein Info for LRK53_RS01740 in Rhodanobacter sp000427505 FW510-R12

Annotation: protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF01135: PCMT" amino acids 21 to 192 (172 residues), 103 bits, see alignment E=5.2e-33 PF00398: RrnaAD" amino acids 69 to 122 (54 residues), 26.5 bits, see alignment E=8.6e-10 PF13649: Methyltransf_25" amino acids 83 to 172 (90 residues), 40.7 bits, see alignment E=8.2e-14 PF08242: Methyltransf_12" amino acids 84 to 173 (90 residues), 30.1 bits, see alignment E=1.6e-10 PF08241: Methyltransf_11" amino acids 84 to 162 (79 residues), 36.5 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 34% identical to PIMT_KORVE: Protein-L-isoaspartate O-methyltransferase (pcm) from Koribacter versatilis (strain Ellin345)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 54% identity to tbd:Tbd_2695)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>LRK53_RS01740 protein-L-isoaspartate O-methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MVMNIEQARVNMVENQVRPWEVLDGRVLEVLGRVRREDFVAAQHRQLAFADLCLPLGHGE
VMMKPVVEGRVLQALELAPTDRVLEIGTGSGFLTACLAGLGGQVTSVDIHADFTAAATQR
LQAAGVTNAILATGEAVREWQPDGLFDALVVTGAVHAVPSRWLDWLKPGARALVIRGLSP
VQQAALLTHEGAGRYREETLFETDLPYLTHAEPPPRFVF