Protein Info for LRK53_RS01640 in Rhodanobacter sp000427505 FW510-R12

Annotation: divalent-cation tolerance protein CutA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03091: CutA1" amino acids 9 to 105 (97 residues), 121.6 bits, see alignment E=5.2e-40

Best Hits

Swiss-Prot: 57% identical to CUTA_THET8: Divalent-cation tolerance protein CutA (cutA) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K03926, periplasmic divalent cation tolerance protein (inferred from 58% identity to xal:XALc_0317)

Predicted SEED Role

"Periplasmic divalent cation tolerance protein cutA" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>LRK53_RS01640 divalent-cation tolerance protein CutA (Rhodanobacter sp000427505 FW510-R12)
MTDPATVLLCYCSCPDAASAQAIAEALVGERLAACVNRLPGVHSTYRWQGAVSQDREELL
LIKTTAVRFDALKSRLLQLHPYELPELVAVPVERGHAAYLDWVREATGEAAQDC