Protein Info for LRK53_RS01600 in Rhodanobacter sp000427505 FW510-R12

Annotation: 50S ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00406: ribosomal protein L11 methyltransferase
  • amino acids 3 to 297 (295 residues), 246.3 bits, E=2.2e-77
• PF06325: PrmA
  • amino acids 3 to 303 (301 residues), 305.2 bits, E=1.5e-94
• PF05175: MTS
  • amino acids 157 to 232 (76 residues), 28.7 bits, E=2.3e-10
• PF13847: Methyltransf_31
  • amino acids 171 to 222 (52 residues), 27.6 bits, 5.5e-10
• PF13649: Methyltransf_25
  • amino acids 174 to 220 (47 residues), 27.2 bits, 1.3e-09
• PF08241: Methyltransf_11
  • amino acids 176 to 240 (65 residues), 23 bits, E=2.6e-08

Best Hits

Swiss-Prot: 56% identical to PRMA_XANC5: Ribosomal protein L11 methyltransferase (prmA) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 60% identity to xal:XALc_0311)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (305 amino acids)

>LRK53_RS01600 50S ribosomal protein L11 methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MPFLELSLIVRIEQQPRAEEALEDLGALSVTLRDADAETPDEQAIFEPGVGELPLWPTIT
LNALFDERADRRGLAAALSELLPWLEPGQLDFTEVADQDWERAWMDQFKPMSFGRRLWIY
PWNIEPPMDEDASGTSARVVIRLDPGLAFGSGTHPTTALCLEWLDGLDLGGKTITDYGCG
SGILAIAALKLGAASATGIDNDPQALTASRDNAERNGVADRLALYLPEDFDTEAADVFIA
NILAGPLGELAPSFAAAAKPGAPFAISGILAGQQDELLQRYAEWFDELRVDTREDWVRIS
GRRRR