Protein Info for LRK53_RS01535 in Rhodanobacter sp000427505 FW510-R12

Annotation: uroporphyrinogen-III synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01719, uroporphyrinogen-III synthase [EC: 4.2.1.75] (inferred from 46% identity to psu:Psesu_0101)

Predicted SEED Role

"Uroporphyrinogen-III synthase (EC 4.2.1.75)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.75)

MetaCyc Pathways

superpathway of heme b biosynthesis from glutamate (9/10 steps found)
tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
superpathway of heme b biosynthesis from glycine (6/8 steps found)
tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
adenosylcobalamin biosynthesis II (aerobic) (12/33 steps found)
superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>LRK53_RS01535 uroporphyrinogen-III synthase (Rhodanobacter sp000427505 FW510-R12)
MTVTARQHPRDKPDLRGRSVVITRPAGTASALARRVRALGGVPLLLPGLALRSVADAVDA
RRGLRAALAAELIVFTSPAAVRHAAALLPLRTTAAVLAVGQGTARALRRHGIATPLAPQR
QDSEGLLEHPELRELRGRRVALVGAPGGRGVLREQLAARGAQLQEVHVYRRVPPRLDRRH
IEALLRLPASARVLLSSAEALHHLQQGLPAAAWARLCAATAVVSSERLAVAARVAGFARI
VPAASALSADLLDAAARTG