Protein Info for LRK53_RS01345 in Rhodanobacter sp000427505 FW510-R12

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 TIGR01391: DNA primase" amino acids 5 to 433 (429 residues), 439 bits, see alignment E=8.4e-136 PF01807: Zn_ribbon_DnaG" amino acids 6 to 99 (94 residues), 131.2 bits, see alignment E=4e-42 PF08275: DNAG_N" amino acids 129 to 267 (139 residues), 115.9 bits, see alignment E=5.5e-37 PF13662: Toprim_4" amino acids 276 to 341 (66 residues), 61.8 bits, see alignment E=2.3e-20 PF13362: Toprim_3" amino acids 277 to 372 (96 residues), 30.9 bits, see alignment E=1.2e-10 PF01751: Toprim" amino acids 277 to 353 (77 residues), 52.4 bits, see alignment E=2e-17 PF13155: Toprim_2" amino acids 278 to 364 (87 residues), 60.1 bits, see alignment E=8.8e-20 PF10410: DnaB_bind" amino acids 385 to 436 (52 residues), 55.5 bits, see alignment 2.2e-18 PF08278: DnaG_DnaB_bind" amino acids 462 to 585 (124 residues), 91.9 bits, see alignment E=1.7e-29

Best Hits

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>LRK53_RS01345 DNA primase (Rhodanobacter sp000427505 FW510-R12)
MRGLIPDSFIDELLARVDIVDVIERRVPLKKAGREWTACCPFHNERTPSFYVSPAKQFFH
CFGCGAHGSAVKFLMDYERLEFPDAVEELAQSVGLTVPREGGRDERPREDKTDLYALLDA
ATAWYEGELPRSADAQAYCRKRGLDAETIKRFRLGWAPAGYDGVIKALGNTPRRMELLNE
AGMVASSERGSKYDRFRERLMFPILDRRGRVIAFGGRIISSAPPAREDQEAGIPARTSQQ
SSSPKYLNSPETPLFHKGRELFALWQVKQANPKLERIVVVEGYMDVIALHQAGLPVAVAT
LGTATTPEHTEVLFRAAPDVVFCFDGDRAGRAAAWKALEAALPRLRDGRQAYFLFLPDGE
DPDTLVRKEGKEGFEKRIREAMPLSDYFFNELARDVDMASLDGRARLAERARPLIARLPD
GAFRDLMAQELEKRSGARAVLQADPATRRAVQRPTAVQRSLVRSAISLLLAQPGMADQVE
RPYRFLRLDKPGVALLAELLDLARARPGINSAMLVEHFAERPEYPSLQKLMAALAVGEPE
AQRSEFFDALARMEDQAATQRRDALTAKSRESTLDPAEKAELRELLAARVRPPVTSA