Protein Info for LRK53_RS01310 in Rhodanobacter sp000427505 FW510-R12

Annotation: COX15/CtaA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 8 to 11 (4 residues), see Phobius details amino acids 30 to 33 (4 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 11 to 117 (107 residues), 87.3 bits, see alignment E=5.1e-29 amino acids 130 to 369 (240 residues), 145.1 bits, see alignment E=1.3e-46

Best Hits

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>LRK53_RS01310 COX15/CtaA family protein (Rhodanobacter sp000427505 FW510-R12)
MSSRSLRWLRWLALFAAVFAFGLVMFGAFVRLSNAGLSCPDWPTCYGQVTWPQHAQAVAH
ADAAFPDRPYEAHKAWREQVHRFLAGTLGVLVLLLALLASWRRRDALLAVLAGAVFAAFG
VGLYMRGEHLWSSLLAACAIALPLIAAIRLPRPGAWKICVLALAVIIFQAMLGMWTVTLL
LKPIVVMGHLLGGMATFALLAYAALRFAGVAAAGDGLADLRRLVAVGIVLLLCQIALGGW
TSANYAALACGYGPGSFPECLGQWAPPADFREGFVLWRGIGVNYEGGVLDMAARSAIQIA
HRLGALVVFCYLGWLAVRTARHGLRALGLAIALALAAQVLLGISNVYFGLPLAVATAHNG
IAALLLFTLLATLARTQRRHDASMFLSLGRA