Protein Info for LRK53_RS01240 in Rhodanobacter sp000427505 FW510-R12

Annotation: ankyrin repeat domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1146 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 168 to 194 (27 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details PF13637: Ank_4" amino acids 345 to 388 (44 residues), 23.2 bits, see alignment (E = 2.1e-08) amino acids 860 to 908 (49 residues), 28.1 bits, see alignment (E = 6e-10) PF12796: Ank_2" amino acids 345 to 427 (83 residues), 35.7 bits, see alignment 3.3e-12 amino acids 441 to 530 (90 residues), 43.1 bits, see alignment 1.5e-14 amino acids 515 to 587 (73 residues), 27.5 bits, see alignment 1.2e-09 amino acids 761 to 835 (75 residues), 41.8 bits, see alignment 4e-14 amino acids 861 to 947 (87 residues), 40.9 bits, see alignment 7.8e-14 amino acids 958 to 1033 (76 residues), 36.8 bits, see alignment 1.4e-12 PF00023: Ank" amino acids 368 to 399 (32 residues), 19 bits, see alignment (E = 4.1e-07) amino acids 468 to 498 (31 residues), 15.8 bits, see alignment (E = 4.4e-06) amino acids 758 to 788 (31 residues), 17 bits, see alignment (E = 1.9e-06) amino acids 789 to 822 (34 residues), 18.4 bits, see alignment (E = 6.5e-07) amino acids 955 to 985 (31 residues), 25.3 bits, see alignment (E = 4.1e-09) amino acids 987 to 1025 (39 residues), 15.8 bits, see alignment (E = 4.4e-06) amino acids 1072 to 1102 (31 residues), 15.5 bits, see alignment (E = 5.3e-06)

Best Hits

Predicted SEED Role

"Ankyrin-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1146 amino acids)

>LRK53_RS01240 ankyrin repeat domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MTQPKSRRRPPLLHALAWFIPGWFAVAVAGLVTHPLTLVPLLLANALTMAATCHAIGFDP
EPRFGRTVLRRGAAHLVMFTGYTVLVFVLVAWPMLQLTHEPSLGAALVLAAALVLALVAL
WRLWPAFGLVFVWDDAYPSQRDGSWIFTATLRSIAFSRHLSREERFFSHFLPAAFALLVL
AFGAIALTGLYGVLPPEPRVAALAIYGAVLLPLGCLVIANRTLRALLCERQQPRRRGDPD
PRVDTAPRPVLSEQERTAGTPEQAAALLAATRDGDIERALALVDAGAAPDTVPPGDDRDQ
RPVLMLAALLPDTRLLRALIAKGADVNRASGGITALLAATRDSWHGRAEAVLTLLANGAS
PLVTDAEGNTPLHGAVLSGDAGVAAMLLDAAAPINALNKAGVSPLATACRAANWPLVKFL
LERGAKPAPADGEPALVAAAGIADDDAEGVKLLLKQRAAVNAVDARHRHALLAAAAEGHE
QIARALCAASADVNLVDRHGSSALMEAARAGAGGIVQLLAEAQADAGLRDSHGRDALTLA
CQSPRAHADTVRALLALGADAKAAGGDGRSALDHAAGAGRWDLVALLDPDTPLPASLSHD
VLAEGNDTPAHLLDALRFGHWAIASGFAERVRDWPQAELARLYLELAGAGHGAARRWLLD
HGLDAEARLEAPRIDDAETADAPHLPPLGQRLFDALLPQLPDATEALDDLLQAGASAAGA
GLLAQALAHLNGAAEGAALPLNLLERGADPFGADARERTPLQLAAANAQLPLLQALLARG
GDPNTRDRDGRTPLFAALEHGAQALPLVRALIAHGANPEATDANGETPLGLALEHPAVER
WLDWRDWPRPNRALRADDLPAAAKAGALASVQRLLELGFAVDTRDDQGATALLHACGAGH
RDIAACLLGAGADATLPARSGVTPLAAAVAARREALVALLLQHQVAVDQRLPNQATALMV
AAAMGYPEIVEQLLDAGAAVNAVDDAGRSALHAAAQFGFEHNDSLRARRLFDRLLKHGAD
INHADHEGKTPLLLLLGAQLRPGSACDATHLGALVPLLLEAGAKVEPADQRGVTALHACA
MHALLPPARVLLSRGADRNAADAFGRTAADVARQLGYVDIAHELAARSSAIPSVRQTLRQ
PAQPSD