Protein Info for LRK53_RS01185 in Rhodanobacter sp000427505 FW510-R12

Annotation: GAF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01590: GAF
  • amino acids 50 to 155 (106 residues), 40.8 bits, E=3.1e-14
• PF13185: GAF_2
  • amino acids 54 to 155 (102 residues), 36.3 bits, E=6.3e-13

Best Hits

Swiss-Prot: 56% identical to YTSP_BACSU: Protein YtsP (ytsP) from Bacillus subtilis (strain 168)

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 77% identity to put:PT7_3424)

MetaCyc: 53% identical to free methionine-(R)-sulfoxide reductase (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]

Predicted SEED Role

"Free methionine-(R)-sulfoxide reductase, contains GAF domain"

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.14

Protein Sequence (163 amino acids)

>LRK53_RS01185 GAF domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MFDLKTHSYASKREHYDDLLRQARGILAGERDLIANAANFSALVYHSLPQLNWAGFYLYD
GTELVVGPFQGKPACIRIALGRGVCGTAAQTRQTQLVRDVNAFAGHIACDAASQSEIVVP
LVKADGGLLGVWDVDSPVTDRFDEDDRAGMEALCAVFMDATCR