Protein Info for LRK53_RS01135 in Rhodanobacter sp000427505 FW510-R12

Annotation: tetratricopeptide repeat-containing sulfotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 PF13432: TPR_16" amino acids 25 to 89 (65 residues), 24.2 bits, see alignment E=2.1e-08 amino acids 95 to 145 (51 residues), 24.9 bits, see alignment 1.3e-08 amino acids 136 to 191 (56 residues), 23.5 bits, see alignment 3.3e-08 PF14559: TPR_19" amino acids 31 to 92 (62 residues), 29.4 bits, see alignment E=4.6e-10 amino acids 69 to 129 (61 residues), 28.4 bits, see alignment E=9.1e-10 amino acids 137 to 199 (63 residues), 30.7 bits, see alignment E=1.8e-10 PF13181: TPR_8" amino acids 123 to 156 (34 residues), 17.6 bits, see alignment (E = 1.8e-06) PF07719: TPR_2" amino acids 123 to 156 (34 residues), 26.4 bits, see alignment (E = 2.7e-09) PF13174: TPR_6" amino acids 125 to 155 (31 residues), 13.1 bits, see alignment (E = 7.1e-05) PF13176: TPR_7" amino acids 125 to 156 (32 residues), 15.3 bits, see alignment (E = 9.3e-06) PF13469: Sulfotransfer_3" amino acids 295 to 483 (189 residues), 87.6 bits, see alignment E=8.5e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>LRK53_RS01135 tetratricopeptide repeat-containing sulfotransferase family protein (Rhodanobacter sp000427505 FW510-R12)
MVARQAHPLLRNRAVGLPAEVVRRLDEASGAMAGGDLARAEAALAAALALVPGNVEALRL
SAQLQQLHGEHAQAVAILRQALAKDPRDALLHIGLGVSLQARGENEAALSALQRACELAP
DFAPAWFNLGRMFQLLGRPAGAITALHRALDLDPEHLAARLLLAAAQASLGAEVQAAANY
REVLRREPGHPEAWSGLSALDAECFGKDDVARLQQVLQMPQPTPHARIQLGFALARALED
QADYRAAFRALRKANAWRHRQLNWNAARMRAHVDAVLAAFAEPLAGAADATVGGPVIFLM
ALPHAGARLTGQVLAAHPYVGGVDESAHLQRVVSEESARRGKPLLQWLGTATPADWARLG
TDYLARIGPVARGRPRLVDAHRLNWRLVGVAMAMLPGARVVHCRRNALETCFACYRELFA
GGHDFSYDLDDLASYWRDHERLGRHWQRLFPQRLLVHDHEALLAEPDATVRRLLTFCGLD
YDEACVGFQHEPADTRMALRTRQSWSREPAMAARYGAELDRLRLLLGAR