Protein Info for LRK53_RS01100 in Rhodanobacter sp000427505 FW510-R12

Annotation: pteridine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 190 (182 residues), 130.6 bits, E=1e-41
• PF08659: KR
  • amino acids 10 to 128 (119 residues), 25.4 bits, E=2.5e-09
• PF13561: adh_short_C2
  • amino acids 16 to 244 (229 residues), 162.7 bits, E=2.3e-51
• PF23441: SDR
  • amino acids 118 to 244 (127 residues), 51.1 bits, E=2.5e-17

Best Hits

KEGG orthology group: K03793, pteridine reductase [EC: 1.5.1.33] (inferred from 59% identity to psu:Psesu_0202)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• superpathway of chorismate metabolism (39/59 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.33

Protein Sequence (248 amino acids)

>LRK53_RS01100 pteridine reductase (Rhodanobacter sp000427505 FW510-R12)
MSPRRDRPVALITGAGRRVGAVTARTLHAAGYDLALHYRHSVDDARALADELERQRGGST
LLLQAELAELPALPALIEQLLAHYGRLDALVNNASAFFPTPLGTTTPQQWNALFASNAQA
PFFLSQAAIPALREARGGIVNMVDIYAERPLAEHAVYCMAKAALAAMTRSLALELAPEVR
VNGVAPGAVLWPSDSKPYADQQAMLARTPLQHAGTPDDVAGTVLWLLRDARYVTGQIIRV
DGGRTLSV