Protein Info for LRK53_RS00945 in Rhodanobacter sp000427505 FW510-R12

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF13560: HTH_31" amino acids 17 to 68 (52 residues), 29.6 bits, see alignment 1.1e-10 PF01381: HTH_3" amino acids 20 to 71 (52 residues), 37.7 bits, see alignment 2.6e-13 PF06114: Peptidase_M78" amino acids 244 to 316 (73 residues), 30.4 bits, see alignment E=4.5e-11

Best Hits

KEGG orthology group: None (inferred from 60% identity to nhl:Nhal_0749)

Predicted SEED Role

"HigA protein (antitoxin to HigB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>LRK53_RS00945 helix-turn-helix domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MTESATRFEPDWVSPPGETIADLLEERGWSQQELAQRLGYSEKHVSQLINGKVPLTDDAA
MRLNSVLGGPVGFWLKREAQYRERLAQQEAKTRFAGWQDWLDQIPVRELMKHGCIAKNRI
DAHSKPAIVEQCLSFFGVASPDGWRARYGTLQHQFRRSREEQCNLGAIAAWLRLGEQVAE
KQSGPRYDEAKFRQALDEMRGLTVLAPEQFAPRLNALFRDSGVIFVLVPALPKSHVSGVA
RWLEADRPLIQLPLYGKTNDRFWFTLFHEAAHILLHGKNRKSKESVFLDDPVRQTSTSAQ
EREANDWARDWLIPSACKRDLVQLKTKLAVLAFAHQLSIHPGIVVGRLQHDEVIPPSWMN
DLKDSFRITEST