Protein Info for LRK53_RS00910 in Rhodanobacter sp000427505 FW510-R12

Annotation: monovalent cation/H+ antiporter subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 964 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 300 to 348 (49 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 408 to 432 (25 residues), see Phobius details amino acids 453 to 474 (22 residues), see Phobius details amino acids 500 to 524 (25 residues), see Phobius details amino acids 576 to 596 (21 residues), see Phobius details amino acids 608 to 625 (18 residues), see Phobius details amino acids 632 to 652 (21 residues), see Phobius details amino acids 658 to 680 (23 residues), see Phobius details amino acids 701 to 720 (20 residues), see Phobius details amino acids 757 to 775 (19 residues), see Phobius details amino acids 814 to 836 (23 residues), see Phobius details amino acids 843 to 863 (21 residues), see Phobius details amino acids 878 to 899 (22 residues), see Phobius details amino acids 920 to 945 (26 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 68 to 112 (45 residues), 33.8 bits, see alignment 6.5e-12 PF00361: Proton_antipo_M" amino acids 128 to 411 (284 residues), 209.5 bits, see alignment E=1.7e-65 PF13244: MbhD" amino acids 617 to 681 (65 residues), 63.1 bits, see alignment 5.3e-21 PF20501: MbhE" amino acids 696 to 792 (97 residues), 154.4 bits, see alignment E=1.8e-49 PF04039: MnhB" amino acids 819 to 939 (121 residues), 116.4 bits, see alignment E=2.6e-37

Best Hits

Swiss-Prot: 61% identical to PHAAB_RHIME: Probable K(+)/H(+) antiporter subunit A/B (phaAB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05559, multicomponent K+:H+ antiporter subunit A (inferred from 59% identity to avi:Avi_5269)

Predicted SEED Role

"Na(+) H(+) antiporter subunit A; Na(+) H(+) antiporter subunit B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (964 amino acids)

>LRK53_RS00910 monovalent cation/H+ antiporter subunit A (Rhodanobacter sp000427505 FW510-R12)
MPDAILPSTILALPFVAALWLLRPRGRRVAVWLMTATALLGLLLSLWLYPAIAGGDALRQ
VIAWAPGLGLDLVLRVDGFAWLFMLLICGIGALVGIYARYYMPADDPLAHFYALLLAFMG
SMLGIVMSGNVVQLVFFWELTSLFSFLLIGYWHHGASARDGARMALIVTSGGGLCLFAGV
LLLGHIAGSYDLDTILAAGDAVRTHALYLPTLLLILLGAFTKSAQFPFHFWLPQAMSAPT
PVSAYLHSATMVKAGVFLLVRFWPVLGGTDAWFWIVGGTGLVTLVLGAYAAMFEQDLKGV
LAYSTISHLGLITMLVGLGSALGVVAAIFHIVNHATFKASLFMAAGAVDHEAGTRDLRKL
GGLRRFMPVTATLALIAGAAMAGVPLLNGFLSKEMFFAETLAARQGPLLNAISVVLAVAA
SAFGVTYSIRFVRGVFFGRVPASLPREPHEPPLWMRVPIGLLALACLLVGMLPARVIGPS
LRAAASAVLGAGQLPEYSLAVWHGVTTPLLMSVLAFVAGCLLFVSLRRRFAALETAPLTG
RFSGKRIFERVMAVVAADLPQRIERRYPSRRLQPQLLLIVLLALVAGTLAATSAPFGFQP
RWSSVDPAFALLWLLGAACAIGAASQAKFHRLAALVLTGGAGLVSCVSFVWLSAPDLAAT
QLLVEVVTTILILLGLRWLPKRIEGLAAESRTHRFRRRRDMVIATAVGLGVASLAYAAMM
HPVADSISRFFLERAYAEGGGHNVVNVILVDFRGFDTLGEISVLAIVALTVFALLRRFRP
AAESINAPAQQRLQTALGASGPGRAADHSLTDYLMIPGLIIQLMSPVIVLFGLHLFLRGH
DLPGGGFVAGITVSVALILLYMARGARWVEAHLRVLPVRWIGLGLLLAAGTGLGSLAFGR
PFLTSYFRHVELLVLGELPLASAVLFDLGVFVVVVGATTLMLIALAHQSLRRPRQPAAPA
EGEG