Protein Info for LRK53_RS00770 in Rhodanobacter sp000427505 FW510-R12
Annotation: NAD(P)/FAD-dependent oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to SQRD_ACIF2: Sulfide-quinone reductase (AFE_1792) from Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 64% identity to tbd:Tbd_2225)MetaCyc: 56% identical to sulfide:quinone oxidoreductase (Rhodobacter capsulatus)
R17-RXN [EC: 1.8.5.4]
Predicted SEED Role
"FAD-dependent pyridine nucleotide-disulphide oxidoreductase"
MetaCyc Pathways
- sulfide oxidation I (to sulfur globules) (1/1 steps found)
- sulfide oxidation III (to sulfite) (3/4 steps found)
- superpathway of sulfide oxidation (Starkeya novella) (3/5 steps found)
- superpathway of sulfide oxidation (Acidithiobacillus ferrooxidans) (6/10 steps found)
- superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.8.5.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (433 amino acids)
>LRK53_RS00770 NAD(P)/FAD-dependent oxidoreductase (Rhodanobacter sp000427505 FW510-R12) MANIVILGAGLGGMSAAYEIRDTVGSGHAITVIGEGPQFNFTPSNPWVAVGWRGQDEIRV DVAQPLARRDIRFIDAGASKVHPADHQIELGDGRKLDYDYLVITTGPRLAFERVPGSGPE GYTQSICTGPHAHRAWLAYQEFLKHPGPIVISAAQGASCFGPAYEFAMIVDTDLRRRKLR DRVPMTYVTAEPYIGHMGLGGIGDSKGLLESELRQRHIKWITNARVRSVESGAMHVEQLD ERGQLQQEHNLPFAFSMLLPSFAGVDAVKEVEGLVNPGGFVLIDEFQRNPAYPNVYAAGV CVAIPPVEVTPVPTGAPKTGLMIESMVTAIAHNLRDAIAGKPPHARATWNAMCLADMGDR GFAFIALPQIPPRNVTKAMTGKWVHLAKVAYEKYFLRKMRKGQADPIYEKTIMEAFGIER LKPDVKADETPAP