Protein Info for LRK53_RS00730 in Rhodanobacter sp000427505 FW510-R12

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details PF25917: BSH_RND" amino acids 68 to 255 (188 residues), 47.1 bits, see alignment E=3.5e-16 PF25885: HH_EMRA" amino acids 104 to 223 (120 residues), 115.9 bits, see alignment E=2.8e-37 PF25963: Beta-barrel_AAEA" amino acids 261 to 338 (78 residues), 29.3 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 48% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 67% identity to pag:PLES_55501)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>LRK53_RS00730 efflux RND transporter periplasmic adaptor subunit (Rhodanobacter sp000427505 FW510-R12)
MSSQTIPDSSGAAAASIPVSPPARNNPRGLLLRLLGGVMLLAAVGWSLWYFLDGRWYEGT
DDAYVNGNVVQITPQVPGTVVSIGADDGDLVHAGDVLVRLDPSDADVALAGAKANLAATV
RKVRGLYSSMNGAQADVAARKTAVDKARADYQRRVALAKSGAISAEELAHASDALTSAES
NLVTAQQQYQTSKVLVDDTVVASHPDVQAAAARLRAAFLDDERATLVAPVDGYVAKRSVQ
VGQRVQPGAALMAVVPLHQVWVDANFKETQLTDMRIGQPVTIESDVYGGKVAYKGKVQSL
GVGTGSAFSLLPAQNATGNWIKIVQRIPVRIVFDDPAQLDRHPLRIGMSLNVDVGLHDRS
GPMLSQRSPSKPAFSTDVYRQQLASADATITQIVHANMAGGK