Protein Info for LRK53_RS00560 in Rhodanobacter sp000427505 FW510-R12

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 180 to 197 (18 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 70 to 243 (174 residues), 32.9 bits, see alignment E=5.8e-12 PF00005: ABC_tran" amino acids 372 to 514 (143 residues), 63.9 bits, see alignment E=2.5e-21

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 55% identity to xca:xccb100_2575)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>LRK53_RS00560 ABC transporter ATP-binding protein/permease (Rhodanobacter sp000427505 FW510-R12)
MKPAESLRAADRPAALLRSLARTLSGVERVETVAYVLLSLGAAFAGSLAALLLVPLVQPG
QALPFGGVLFDPRRSVELQATAFVAATGAFALLRWQAARLGARLVGRYGMHLRRAAHARL
IEAPLSSLADATSAEIANVLTHNVELIVQGFSALQQLLIAGVSAAVSLGFAFWVSPPLML
AAPVLMGLGLLASRAYGREQSLVARQYVVDMTRLFWHSEDFPRRLRHVRSFEREAAEQAS
YGAISGRLCHGYRRQLELVASGRLLLELLAAAGIAALFVLAHRWHGVEQAELIAVCLLLG
RLLPYLVTTRQSFQQLRSAAPAFELWQRYMNLEPVYASAASPQADASGAALHIERMRLTP
PPGGLEIGGLVLRPGELTLVCGDSGIGKSSLVDVLAGMMTPEVFVAHRDGRPIDFGAYRE
LVRHGAYVSQDVRPWQHSVRECLRWAAPDATDAMLCDALADVGLDKRLAEAPQGLDTELR
GASSRLSGGELQRLLLAQVILRQPFLAVLDEATSALDAASETAVLATIRRRLPQTILVVV
SHRPGVAAIADRYLTIGSDLVATVAGRPVRGVAVAGSSKLLEKASPLS