Protein Info for LRK53_RS00510 in Rhodanobacter sp000427505 FW510-R12

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF13489: Methyltransf_23" amino acids 38 to 196 (159 residues), 53.6 bits, see alignment E=8.8e-18 PF01209: Ubie_methyltran" amino acids 41 to 148 (108 residues), 42.5 bits, see alignment E=2e-14 PF03141: Methyltransf_29" amino acids 43 to 150 (108 residues), 23.5 bits, see alignment E=8.1e-09 PF06325: PrmA" amino acids 43 to 149 (107 residues), 31.3 bits, see alignment E=6.3e-11 PF13847: Methyltransf_31" amino acids 46 to 152 (107 residues), 55.5 bits, see alignment E=2.1e-18 PF13649: Methyltransf_25" amino acids 49 to 144 (96 residues), 80.2 bits, see alignment E=6.2e-26 PF08242: Methyltransf_12" amino acids 50 to 146 (97 residues), 58.6 bits, see alignment E=3.6e-19 PF08241: Methyltransf_11" amino acids 50 to 147 (98 residues), 88.6 bits, see alignment E=1.4e-28

Best Hits

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 73% identity to xcv:XCV1731)

Predicted SEED Role

"biotin synthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>LRK53_RS00510 class I SAM-dependent methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MTAQPTLEPRAAYALWAPGYPARAHNPVMQAEERAMLALMPASLRGQAVLDVGCGSGRYM
LHALRRGVARVTGVDLSPHMLKRADTELAALHAGVPVALVQGSVAALPLPDAQADFTVCG
LVVGHLDNLEPALAELRRVTRPGGTLLLSDVHPIGHALGWRRDFKAGGLSYAVRHTPHLY
SHWHRACATLGLQIEQVLEPMLDPADVPAGAHFDRMALEVPVALVFQLRRAP