Protein Info for LRK53_RS00480 in Rhodanobacter sp000427505 FW510-R12

Annotation: O-antigen translocase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 5 to 273 (269 residues), 54.1 bits, see alignment E=1.7e-18 PF13440: Polysacc_synt_3" amino acids 31 to 329 (299 residues), 56.2 bits, see alignment E=3.3e-19

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 70% identity to xcv:XCV1725)

Predicted SEED Role

"lipopolysaccharide biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>LRK53_RS00480 O-antigen translocase (Rhodanobacter sp000427505 FW510-R12)
MNIARAGFYSGLATAARLLAALVVVKLVAWFAGPEGVGKLGQFMSLMSLLAVLAGGGISA
GIVKYVAEYREDPQRLARLLAAALWYALCASLLMGCLALAFSRPLASWLLDDPAYAGLIR
VLAVAQLGIALVNYILAVVNGFMDVRRLALIQVLGSLLSIATVIALARWLQLYGALLALV
LGQLLWLLVGLPAWWRSPYFRRSMLRLRFDREMTWRLAAFSVMTLTAALVSPLVNIAVRD
HLALQLGWQQVGYWQAVGKVSDAYLLFLTAAINIYYLPKLASIQGRDALLAELRHAYRYI
LPVVVLLAASVYLLREPLTRWLFSADFAPANALYAPQLVGDVIKIAAFILSYVMLAKAMT
RLFVISECVFAASYLALVYVFTARFGLVGAMYAFAANYLGYLAFNLLVVRRYLGGL