Protein Info for LRK53_RS00460 in Rhodanobacter sp000427505 FW510-R12

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR03570: sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family" amino acids 5 to 208 (204 residues), 186.7 bits, see alignment E=1.9e-59 PF00132: Hexapep" amino acids 106 to 141 (36 residues), 29.7 bits, see alignment 1.8e-11

Best Hits

KEGG orthology group: None (inferred from 75% identity to xac:XAC1688)

Predicted SEED Role

"transferase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>LRK53_RS00460 acetyltransferase (Rhodanobacter sp000427505 FW510-R12)
MPKPLVLVGAGEFAQIACEYFEHDGDRDVVAFSVERDYLAQPQLAGRPVVAYETLEAHYP
PAGFDVFVAIPASQLNRLRTRFYLDAKRRGYRLASYVSSRAFVWRNAEVGENSFIFEGNV
VQPFVRIGDNCVLWSGNHVGHRTVVHDHVFVASHAVISGYCEIGQSSFVGVNSTFNDHVK
VAADNVIGAGALVTRDTEPGRVYVGSPAHALPGKSSLDVRL