Protein Info for LRK53_RS00290 in Rhodanobacter sp000427505 FW510-R12

Annotation: Xaa-Pro peptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details PF01321: Creatinase_N" amino acids 91 to 225 (135 residues), 74.9 bits, see alignment E=9e-25 PF00557: Peptidase_M24" amino acids 233 to 435 (203 residues), 180.3 bits, see alignment E=4.2e-57

Best Hits

KEGG orthology group: K01271, Xaa-Pro dipeptidase [EC: 3.4.13.9] (inferred from 40% identity to pat:Patl_3488)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.13.9

Use Curated BLAST to search for 3.4.13.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>LRK53_RS00290 Xaa-Pro peptidase family protein (Rhodanobacter sp000427505 FW510-R12)
MQLPPGWSESLPRAAAYRGAMMETSNTIHLGRRRFLQASAMGAAALSTSLLAGEAVARQG
TGCASLPPSIMALQPVQSQIVPITDAERRARLNRAQQFMAENKMDAIFMDGGASLNYFTG
MHWFTSERTMGMLLPRSGDPIYITPAFELSRALEQIKFGHDVRAWQEHESPYEKIAQIMA
ELHASTGTLGIEDQVPFSRATNIGNAMPHVRLVSAMPVTAGCRSIKSPAELAQMQVANNA
TLAVYHAVWKALEPGMTQQQVLDWIGAAYGRQGLAGEAIVNVGKYSAQPHGSIAPQKIVE
GTVVLIDEGCFVEGYQSDITRTFVLGKASDKMKKVFGIVQKAQQAALKAAHPGATMESVD
AAARKVIVDGGYGPDYKYFAHRLGHGIGMDMHEWYYLVRGNKRKILANMTFSDEPGIYIP
GEFGVRLEDIMYVTDDGARWFTPQSPSIEQPFG