Protein Info for LRK53_RS00285 in Rhodanobacter sp000427505 FW510-R12

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 48 to 65 (18 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 269 to 301 (33 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details PF01594: AI-2E_transport" amino acids 57 to 375 (319 residues), 134.1 bits, see alignment E=3.8e-43

Best Hits

KEGG orthology group: None (inferred from 34% identity to xal:XALc_0430)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>LRK53_RS00285 AI-2E family transporter (Rhodanobacter sp000427505 FW510-R12)
MSESAPVLPPAPGDVVATPPAPPATGTALHPEPPRLAAARATRRHLRALRVVLNTLLLLA
LLYTITLSKALLIPLVLAAFIGLALNPIVAFGTRLHLPRWLTASVLMLGLIVGIGSGVGL
LAQPAVGWFHDAPAAIKSFVPKLRSFTRPLEAANRATQTLVSGSTRAPAPQATPISISAW
DVVATTPKVLAAVLGVLLLVFFFLIYGDSMLRRLVEITPGFTYKRHAVSIVRGIQSEVSR
YLLTALLINASLGAVTAGMLWLYKVPDPLLWGAVAMFANFIPYVGAIVTTSLLAVVCMLY
ASDASLEVFLPVLTFAGITAVEGNLITPLIQGASMRLSPIAILLWLLLWGWLWGIPGALL
AVPMLTCTKLICERVRGWEWFAHIVQR