Protein Info for LRK53_RS00090 in Rhodanobacter sp000427505 FW510-R12

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 556 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 317 to 334 (18 residues), see Phobius details amino acids 459 to 483 (25 residues), see Phobius details amino acids 504 to 522 (19 residues), see Phobius details amino acids 528 to 546 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 27 to 236 (210 residues), 99.8 bits, see alignment E=1.8e-32 amino acids 227 to 341 (115 residues), 22.4 bits, see alignment E=5.3e-09 amino acids 450 to 554 (105 residues), 25 bits, see alignment E=8.6e-10 PF07690: MFS_1" amino acids 30 to 334 (305 residues), 82.9 bits, see alignment E=2.2e-27

Best Hits

KEGG orthology group: None (inferred from 72% identity to bbr:BB2073)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (556 amino acids)

>LRK53_RS00090 MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MATTAIDAIGGNASGKLDVSHKRVILASSLGTVFEWYDFYLYGSLAVIIGHQFFSGLNEA
SQLVFALLAFAAGFAVRPFGALVFGRVGDLVGRKYTFLITIVIMGLSTFFVGLLPSYGSI
GVAAPVILIALRMLQGLALGGEYGGAATYVAEHAPPGKRGLYTSFIQITATFGLFLSLLV
ILGCKWLLGDKFNDWGWRIPFLLSSLLLAVSVYIRMQLAESPVFEQMKEEGKTSKAPLTE
SFARWGNLKLVILALLGATAGQAVVWYCGQFYAMYFLGSTLKIDATTTQLLIAAALLIGT
PFFVFFGWLSDKIGRKPVVLAGCLLAALTYFPIFKGLTHYGNPAIEAASVAAPVKVQADP
AGCSVQIDLIGKKVFTSSCDVAKSYLAKRGVPYENVAAAPGTVAVVSVGGQNFTAFEGGA
LAKADFTAQSKAFGDSVGKALAAAGYPAKADPAQTNTPMLVVLLTLLVIYVTMVYGPIAA
WLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPSVSFGIVAATGNFYAGLWYPVAIAAMTFV
IGTLFVRETKDVDLSD