Protein Info for KEDOAH_27290 in Escherichia coli ECRC99

Name: tam
Annotation: trans-aconitate 2-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF13489: Methyltransf_23" amino acids 13 to 176 (164 residues), 58.1 bits, see alignment E=3.3e-19 PF01728: FtsJ" amino acids 22 to 97 (76 residues), 30.6 bits, see alignment E=1.1e-10 PF05175: MTS" amino acids 23 to 100 (78 residues), 24.4 bits, see alignment E=7e-09 PF13847: Methyltransf_31" amino acids 35 to 141 (107 residues), 51.3 bits, see alignment E=3.9e-17 PF13649: Methyltransf_25" amino acids 35 to 124 (90 residues), 66.4 bits, see alignment E=1.1e-21 PF08242: Methyltransf_12" amino acids 37 to 126 (90 residues), 49.5 bits, see alignment E=2.1e-16 PF08241: Methyltransf_11" amino acids 37 to 127 (91 residues), 56.5 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 100% identical to TAM_ECO5E: Trans-aconitate 2-methyltransferase (tam) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K00598, trans-aconitate 2-methyltransferase [EC: 2.1.1.144] (inferred from 100% identity to eok:G2583_1884)

MetaCyc: 97% identical to trans-aconitate 2-methyltransferase (Escherichia coli K-12 substr. MG1655)
Trans-aconitate 2-methyltransferase. [EC: 2.1.1.144]

Predicted SEED Role

"Trans-aconitate 2-methyltransferase (EC 2.1.1.144)" (EC 2.1.1.144)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.144

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>KEDOAH_27290 trans-aconitate 2-methyltransferase (Escherichia coli ECRC99)
MSDWNPSLYLHFAAERSRPAVELLARVPLENVDYVADLGCGPGNSTALLHQRWPAARITG
IDSSPAMIAEARSALPDCQFVEADIRNWQPEQALDLIFANASLQWLPDHYELFPHLVSLL
NPQGVLAVQMPDNWLEPTHVLMREVAWEQNYPDRGRESLAGVHAYYDILSEAGCEVDIWR
TTYYHQMPSHQAIIDWVTATGLRPWLQDLTESEQQLFLTRYHQMLKEQYPLQENGQILLA
FPRLFIVARRTE