Protein Info for KEDOAH_22655 in Escherichia coli ECRC99

Name: dnaC
Annotation: DNA replication protein DnaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF01695: IstB_IS21" amino acids 50 to 219 (170 residues), 69.2 bits, see alignment E=3.9e-23 PF00308: Bac_DnaA" amino acids 69 to 188 (120 residues), 32.7 bits, see alignment E=7.4e-12

Best Hits

Swiss-Prot: 80% identical to YDAV_ECOLI: Uncharacterized protein YdaV (ydaV) from Escherichia coli (strain K12)

KEGG orthology group: K10762, putative replication protein (inferred from 99% identity to eoi:ECO111_2609)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>KEDOAH_22655 DNA replication protein DnaC (Escherichia coli ECRC99)
MKNIAAAGVLERIRRLAPQASVPPYRTVEEWREWQLAEGRKRSEEINRQNHQLRVEKILN
RSGIQPLHSKCSFANYQVQNDGQKYALSQAKSIADELMTGCTNFVFSGKTGTGKNHLAAA
MGNRLMAKGRSVIIVTVSDVMSVLHDSYDNGKSGEKFLQELCSVDLLVLDEIGVQRETKN
EQVVLHQIIDRRTASLCSVGMLTNLNHAAMSTLLGERIMDRMTMNGGRWVTFNWDSWRPN
VSNMRVVK