Protein Info for KEDOAH_16515 in Escherichia coli ECRC99

Name: nanS
Annotation: putative 9-O-acetyl-N-acetylneuraminic acid deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF03629: SASA" amino acids 75 to 209 (135 residues), 48.4 bits, see alignment E=4.7e-17

Best Hits

Swiss-Prot: 98% identical to NANS_ECOLI: Probable 9-O-acetyl-N-acetylneuraminic acid deacetylase (nanS) from Escherichia coli (strain K12)

KEGG orthology group: K07497, putative transposase (inferred from 98% identity to eco:b4309)

MetaCyc: 98% identical to N-acetyl-9-O-acetylneuraminate esterase (Escherichia coli K-12 substr. MG1655)
Sialate O-acetylesterase. [EC: 3.1.1.53]

Predicted SEED Role

"FIG00639826: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>KEDOAH_16515 putative 9-O-acetyl-N-acetylneuraminic acid deacetylase (Escherichia coli ECRC99)
MNAIISPDYYYVLTVAGQSNAMAYGEGLPLPDREDAPHPRIKQLARFAHTHPGGPSCHFN
DIIPLTHCPHDVQDMQSYHHPLATNHQTQYGTVGQALHIARKLLPFIPDNAGILIVPCCR
GGSAFTAGSEGTYSERHGASHDACRWGTDTPLYQDLVSRTRAALVKNPQNKFLGVCWMQG
EFDLMTSDYASHPQHFNHMVEAFRRDLKQYHSQLNNITDAPWFCGDTTWYWKENFPHAYE
AIYGNYQNNILANIIFVDFQQQGARGLTNAPDEDPDDLSTGYYGSAYRSPENWTTALRSS
HFSSAARRGIISDRFVEAILQFWRER