Protein Info for KEDOAH_12850 in Escherichia coli ECRC99

Name: escS
Annotation: type III secretion system LEE export apparatus protein EscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 transmembrane" amino acids 14 to 39 (26 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details TIGR01403: type III secretion protein, HrpO family" amino acids 6 to 85 (80 residues), 114.6 bits, see alignment E=8.2e-38 PF01313: Bac_export_3" amino acids 7 to 77 (71 residues), 81.6 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 43% identical to SSAS_SALTY: Secretion system apparatus protein SsaS (ssaS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03227, type III secretion protein SctS (inferred from 100% identity to ecg:E2348C_3962)

Predicted SEED Role

"Type III secretion inner membrane protein (YscS,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (89 amino acids)

>KEDOAH_12850 type III secretion system LEE export apparatus protein EscS (Escherichia coli ECRC99)
MDTGYFVQLCVQTFWIIFILSLPTVIAASVIGIIISLVQAITQLQDQTLPFLLKIIAVFA
TLALTYHWMGTTIINFSSIIFEMIPKVNG