Protein Info for KEDOAH_11650 in Escherichia coli ECRC99

Name: fba
Annotation: class II aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00167: ketose-bisphosphate aldolase" amino acids 1 to 275 (275 residues), 221.2 bits, see alignment E=9.3e-70 PF01116: F_bP_aldolase" amino acids 7 to 276 (270 residues), 274.6 bits, see alignment E=5.2e-86

Best Hits

Swiss-Prot: 36% identical to GATY_SALTY: D-tagatose-1,6-bisphosphate aldolase subunit GatY (gatY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to eum:ECUMN_3969)

MetaCyc: 40% identical to D-tagatose-bisphosphate aldolase (Bacillus licheniformis)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

"Fructose-bisphosphate aldolase (EC 4.1.2.13)" (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13, 4.1.2.40

Use Curated BLAST to search for 4.1.2.13 or 4.1.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>KEDOAH_11650 class II aldolase (Escherichia coli ECRC99)
MPLVNGRILLDRIQEKRVLAGAFNTTNLETTISILNAIERSGLPNFIQIAPTNAQLSGYD
YIYEIVKRHADKMDVPVSLHLDHGKTQEDVKQAVRAGFTSVMIDGAAFSFEENIAFTQEA
VDFCKSYGVPVEAELGAILGKEDDHVSEADCKTEPEKVKTFVERTGCDMLAVSIGNVHGL
DDIPRIDIPLLKRIAEVCPVPLVIHGGSGIAPEILRSFVNYRVAKVNIASDLRKAFITAV
GKAYVNNHNEANLARVMASAKNAVEEDVYSKILMMNEGHRLVRKAS