Protein Info for KEDOAH_09235 in Escherichia coli ECRC99

Name: ftsP
Annotation: cell division protein FtsP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 3 to 25 (23 residues), 16.8 bits, see alignment (E = 3.4e-07) PF07732: Cu-oxidase_3" amino acids 52 to 166 (115 residues), 96.1 bits, see alignment E=1.6e-31 PF07731: Cu-oxidase_2" amino acids 361 to 468 (108 residues), 47.6 bits, see alignment E=1.5e-16

Best Hits

Swiss-Prot: 100% identical to FTSP_ECOLI: Cell division protein FtsP (ftsP) from Escherichia coli (strain K12)

KEGG orthology group: K04753, suppressor of ftsI (inferred from 100% identity to eco:b3017)

Predicted SEED Role

"Putative cell division protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>KEDOAH_09235 cell division protein FtsP (Escherichia coli ECRC99)
MSLSRRQFIQASGIALCAGAVPLKASAAGQQQPLPVPPLLESRRGQPLFMTVQRAHWSFT
PGTRASVWGINGRYLGPTIRVWKGDDVKLIYSNRLTENVSMTVAGLQVPGPLMGGPARMM
SPNADWAPVLPIRQNAATLWYHANTPNRTAQQVYNGLAGMWLVEDEVSKSLPIPNHYGVD
DFPVIIQDKRLDNFGTPEYNEPGSGGFVGDTLLVNGVQSPYVEVSRGWVRLRLLNASNSR
RYQLQMSDGRPLHVISGDQGFLPAPVSVKQLSLAPGERREILVDMSNGDEVSITCGEAAS
IVDRIRGFFEPSSILVSTLVLTLRPTGLLPLVTDSLPMRLLPTEIMAGSPIRSRDISLGD
DPGINGQLWDVNRIDVTAQQGTWERWTVRADEPQAFHIEGVMFQIRNVNGAMPFPEDRGW
KDTVWVDGQVELLVYFGQPSWAHFPFYFNSQTLEMADRGSIGQLLVNPVP