Protein Info for KEDOAH_06675 in Escherichia coli ECRC99

Annotation: Alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF08240: ADH_N" amino acids 2 to 68 (67 residues), 39.8 bits, see alignment E=9.5e-14 PF16912: Glu_dehyd_C" amino acids 98 to 260 (163 residues), 39 bits, see alignment E=1.3e-13 PF00107: ADH_zinc_N" amino acids 107 to 234 (128 residues), 91 bits, see alignment E=1.2e-29 PF13602: ADH_zinc_N_2" amino acids 161 to 271 (111 residues), 28.2 bits, see alignment E=6.7e-10

Best Hits

Predicted SEED Role

"Hypothetical zinc-type alcohol dehydrogenase-like protein YphC" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>KEDOAH_06675 Alcohol dehydrogenase (Escherichia coli ECRC99)
MGQGCRHFKEGDRVLVYHISGCGFCPNCRRGFPISCTGEGKAAYGWQRDGGHAEYLLAEE
KDLILLPDALSYEDGAFISCGVGTAYEGILRGEVSGSDNVLVVGLGPVGMMGMMLAKGRG
AKRIIGVDMLPERLAMAKQLGVMDHGYLATTEGLPQIIAELTHGGADVALDCSGNAAGRL
LALQSTADWGRVVYIGETGKVEFEVSADLMHHQRRIIGSWVTSLFHMEKCAHDLTDWKLW
PRNAITHRFSLEQAGDAYALMASGKCGKVVINFPD