Protein Info for KEDOAH_04925 in Escherichia coli ECRC99

Name: napG
Annotation: ferredoxin-type protein NapG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details TIGR00397: MauM/NapG family ferredoxin-type protein" amino acids 10 to 216 (207 residues), 234.7 bits, see alignment E=4.1e-74 PF00037: Fer4" amino acids 59 to 76 (18 residues), 26.7 bits, see alignment (E = 1.3e-09) PF12838: Fer4_7" amino acids 60 to 115 (56 residues), 33.2 bits, see alignment E=2.1e-11

Best Hits

Swiss-Prot: 100% identical to NAPG_SHIFL: Ferredoxin-type protein NapG (napG) from Shigella flexneri

KEGG orthology group: K02573, ferredoxin-type protein NapG (inferred from 100% identity to eco:b2205)

MetaCyc: 100% identical to ferredoxin-type protein NapG (Escherichia coli K-12 substr. MG1655)
RXN-18584 [EC: 7.1.1.8]

Predicted SEED Role

"Ferredoxin-type protein NapG (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>KEDOAH_04925 ferredoxin-type protein NapG (Escherichia coli ECRC99)
MSRSAKPQNGRRRFLRDVVRTAGGLAAVGVALGLQQQTARASGVRLRPPGAINENAFASA
CVRCGQCVQACPYDTLKLATLASGLSAGTPYFVARDIPCEMCEDIPCAKVCPSGALDREI
ESIDDARMGLVVLVDQENCLNFQGLRCDVCYRECPKIDEAITLELERNTRTGKHARFLPT
VHSDACTGCGKCEKVCVLEQPAIKVLPLSLAKGELGHHYRFGWLEGNNGKS