Protein Info for KEDOAH_03735 in Escherichia coli ECRC99

Name: wzy
Annotation: O157 family O-antigen polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 147 to 173 (27 residues), see Phobius details amino acids 189 to 207 (19 residues), see Phobius details amino acids 300 to 323 (24 residues), see Phobius details amino acids 333 to 350 (18 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details TIGR04370: oligosaccharide repeat unit polymerase" amino acids 7 to 368 (362 residues), 44.2 bits, see alignment E=6.5e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecs:ECs2844)

MetaCyc: 100% identical to Escherichia coli O:157 antigen polymerase monomer (Escherichia coli O157)
RXN-22143 [EC: 2.4.99.27]

Predicted SEED Role

"O antigen polymerase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.99.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>KEDOAH_03735 O157 family O-antigen polymerase (Escherichia coli ECRC99)
VKSAAKLIFLFLFTLYSLQLYGVIIDDRITNFDTKVLTSIIIIFQIFFVLLFYLTIINER
KQQKKFIVNWELKLILVFLFVTIEIAAVVLFLKEGIPIFDDDPGGAKLRIAEGNGLYIRY
IKYFGNIVVFALIILYDEHKFKQRTIIFVYFTTIALFGYRSELVLLILQYILITNILSKD
NRNPKIKRIIGYFLLVGVVCSLFYLSLGQDGEQNDSYNNMLRIINRLTIEQVESVPYVVS
ESIKNDFFPTPELEKELKAIINRIQGIKHQDLFYGERLHKQVFGDMGANFLSVTTYGAEL
LVFFGFLCVFIIPLGIYIPFYLLKRMKKTHSSINCAFYSYIIMILLQYLVAGNASAFFFG
PFLSVLIMCTPLILLHDTLKRLSRNENISYNCDL