Protein Info for KEDOAH_02480 in Escherichia coli ECRC99

Name: yedI
Annotation: Inner membrane protein YedI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 74 to 102 (29 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 220 to 250 (31 residues), see Phobius details amino acids 269 to 294 (26 residues), see Phobius details PF05661: DUF808" amino acids 6 to 291 (286 residues), 377.9 bits, see alignment E=1.6e-117

Best Hits

Swiss-Prot: 99% identical to YEDI_ECOLI: Inner membrane protein YedI (yedI) from Escherichia coli (strain K12)

KEGG orthology group: K09781, hypothetical protein (inferred from 99% identity to eco:b1958)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>KEDOAH_02480 Inner membrane protein YedI (Escherichia coli ECRC99)
MLLAGSSLLTLLDDIATLLDDISVMGKLAAKKTAGVLGDDLSLNAQQVSGVRANRELPVV
WGVAKGSLINKVILVPLALIISAFIPWAITPLLMIGGAFLCFEGVEKVLHMLEARKHKED
PAQSQQRLEKLAAQDPLKFEKDKIKGAIRTDFILSAEIVAITLGIVAEAPLLNQVLVLSG
IALVVTVGVYGLVGVIVKIDDLGYWLAEKSSALMQALGKGLLIIAPWLMKALSIVGTLAM
FLVGGGIVVHGIAPLHHAIEHFAGQQSAVVAMILPTVLNLILGFIIGGIVVLGVKAVAKM
RGQVH