Protein Info for JDDGAC_28470 in Escherichia coli ECRC98

Name: wcaI
Annotation: colanic acid biosynthesis fucosyltransferase WcaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 84 to 100 (17 residues), see Phobius details TIGR04007: colanic acid biosynthesis glycosyltransferase WcaI" amino acids 1 to 407 (407 residues), 898.3 bits, see alignment E=2.3e-275 PF13579: Glyco_trans_4_4" amino acids 15 to 204 (190 residues), 88.5 bits, see alignment E=1.3e-28 PF13439: Glyco_transf_4" amino acids 16 to 203 (188 residues), 31.7 bits, see alignment E=3e-11 PF00534: Glycos_transf_1" amino acids 219 to 390 (172 residues), 90.3 bits, see alignment E=2.2e-29 PF13692: Glyco_trans_1_4" amino acids 232 to 375 (144 residues), 29.6 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 99% identical to WCAI_ECOLI: Putative colanic acid biosynthesis glycosyl transferase WcaI (wcaI) from Escherichia coli (strain K12)

KEGG orthology group: K03208, colanic acid biosynthesis glycosyl transferase WcaI (inferred from 99% identity to eco:b2050)

MetaCyc: 99% identical to colanic acid biosynthesis fucosyltransferase WcaI (Escherichia coli K-12 substr. MG1655)
2.4.1.-

Predicted SEED Role

"Colanic acid biosysnthesis glycosyl transferase WcaI" in subsystem Colanic acid biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>JDDGAC_28470 colanic acid biosynthesis fucosyltransferase WcaI (Escherichia coli ECRC98)
MKILVYGINYSPELTGIGKYTGEMVEWLAAQGHEVRVISAPPYYPQWQVGENYSAWRYKR
EEGAATVWRCPLYVPKQPSTLKRLLHLGSFAVSSFFPLMAQRRWKPDRIIGVVPTLFCTP
GMRLLAKLSGARTVLHIQDYEVDAMLGLGLAGKGKGGKVAQLATAFERSGLHNVDNVSTI
SRSMMNKAIEKGVAAENVIFFPNWSEIARFQHVADADVDALRNQLGLPDNKKIILYSGNI
GEKQGLENVIEAADRLRDEPLIFAIVGQGGGKARLEKMAQQRGLRNMQFFPLQSYDALPA
LLKMGDCHLVVQKRGAADAVLPSKLTNILAVGGNAVITAEAHTELGQLCETFPGIAVCVE
PESVEALVAGIRQALLLPKHNTVAREYAERTLDKENVLRQFINDIRG