Protein Info for JDDGAC_27220 in Escherichia coli ECRC98
Name: napG
Annotation: ferredoxin-type protein NapG
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NAPG_SHIFL: Ferredoxin-type protein NapG (napG) from Shigella flexneri
KEGG orthology group: K02573, ferredoxin-type protein NapG (inferred from 100% identity to eco:b2205)MetaCyc: 100% identical to ferredoxin-type protein NapG (Escherichia coli K-12 substr. MG1655)
RXN-18584 [EC: 7.1.1.8]
Predicted SEED Role
"Ferredoxin-type protein NapG (periplasmic nitrate reductase)" in subsystem Nitrate and nitrite ammonification
MetaCyc Pathways
- sn-glycerol 3-phosphate anaerobic respiration (3/3 steps found)
- formate to nitrite electron transfer (2/3 steps found)
- aerobic respiration I (cytochrome c) (2/4 steps found)
- aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
- Fe(II) oxidation (1/6 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.1.1.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (231 amino acids)
>JDDGAC_27220 ferredoxin-type protein NapG (Escherichia coli ECRC98) MSRSAKPQNGRRRFLRDVVRTAGGLAAVGVALGLQQQTARASGVRLRPPGAINENAFASA CVRCGQCVQACPYDTLKLATLASGLSAGTPYFVARDIPCEMCEDIPCAKVCPSGALDREI ESIDDARMGLVVLVDQENCLNFQGLRCDVCYRECPKIDEAITLELERNTRTGKHARFLPT VHSDACTGCGKCEKVCVLEQPAIKVLPLSLAKGELGHHYRFGWLEGNNGKS