Protein Info for JDDGAC_25240 in Escherichia coli ECRC98

Name: hcaB
Annotation: 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00106: adh_short" amino acids 9 to 194 (186 residues), 136.1 bits, see alignment E=1.6e-43 PF13561: adh_short_C2" amino acids 16 to 256 (241 residues), 108.3 bits, see alignment E=7.4e-35

Best Hits

Swiss-Prot: 100% identical to HCAB_ECO57: 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase (hcaB) from Escherichia coli O157:H7

KEGG orthology group: K05711, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase [EC: 1.3.1.-] (inferred from 99% identity to eco:b2541)

MetaCyc: 99% identical to 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase (Escherichia coli K-12 substr. MG1655)
PHENPRODIOLDEHYDROG-RXN [EC: 1.3.1.87]; 1.3.1.87 [EC: 1.3.1.87]

Predicted SEED Role

"2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase (EC 1.3.1.-)" in subsystem Cinnamic Acid Degradation or Naphtalene and antracene degradation or Phenylpropanoid compound degradation or Phenylpropionate Degradation (EC 1.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.- or 1.3.1.87

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>JDDGAC_25240 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase (Escherichia coli ECRC98)
MSDLHNESIFITGGGSGLGLALVERFIEEGAQVATLELSAAKVASLRQRFGEHILAVEGN
VTCYADYQRAVDQILTRSGKLDCFIGNAGIWDHNASLVNTPAETLETGFHELFNVNVLGY
LLGAKACAPALIAGEGSMIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPKVRV
NGVGPCGMASDLRGPQALGQSETSIMQSLTPEKIAAILPLQFFPQPADFTGPYVMLASRR
NNRALSGVMINADAGLAIRGIRHVAAGLDL