Protein Info for JDDGAC_23985 in Escherichia coli ECRC98

Name: ygcU
Annotation: Uncharacterized FAD-linked oxidoreductase YgcU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF01565: FAD_binding_4" amino acids 51 to 190 (140 residues), 123.8 bits, see alignment E=4.5e-40 PF02913: FAD-oxidase_C" amino acids 228 to 478 (251 residues), 69.1 bits, see alignment E=4.9e-23

Best Hits

Swiss-Prot: 100% identical to YGCU_ECO57: Uncharacterized FAD-linked oxidoreductase YgcU (ygcU) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b4463)

Predicted SEED Role

"Predicted FAD containing dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>JDDGAC_23985 Uncharacterized FAD-linked oxidoreductase YgcU (Escherichia coli ECRC98)
MSLSRAAIVDQLKEIVGADRVITDETVLKKNSIDRFRKFPDIHGIYTLPIPAAVVKLGST
EQVSRVLNFMNAHKINGVPRTGASATEGGLETVVENSVVLDGSAMNQIINIDIENMQATA
QCGVPLEVLENALREKGYTTGHSPQSKPLAQMGGLVATRSIGQFSTLYGAIEDMVVGLEA
VLADGTVTRIKNVPRRAAGPDIRHIIIGNEGALCYITEVTVKIFKFTPENNLFYGYILED
MKTGFNILREIMVEGYRPSIARLYDAEDGTQHFTHFADGKCVLIFMAEGNPRIAKATGEG
IAEIVARYPQCQRVDSKLIETWFNNLNWGPDKVAAERVQILKTGNMGFTTEVSGCWSCIH
EIYESVINRIRTEFPHADDITMLGGHSSHSYQNGTNMYFVYDYNVVNCKPEEEIDKYHNP
LNKIICEETIRLGGSMVHHHGIGKHRVHWSKLEHGSAWALLEGLKKQFDPNGIMNTGTIY
PIEK