Protein Info for JDDGAC_20705 in Escherichia coli ECRC98
Name: nudE
Annotation: ADP compounds hydrolase NudE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NUDE_ECOLI: ADP compounds hydrolase NudE (nudE) from Escherichia coli (strain K12)
KEGG orthology group: K08312, ADP-ribose diphosphatase [EC: 3.6.1.-] (inferred from 100% identity to eco:b3397)MetaCyc: 100% identical to ADP-sugar diphosphatase NudE (Escherichia coli K-12 substr. MG1655)
ADP-sugar diphosphatase. [EC: 3.6.1.21]
Predicted SEED Role
"ADP compounds hydrolase NudE (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)
KEGG Metabolic Maps
- Folate biosynthesis
- Fructose and mannose metabolism
- Lipopolysaccharide biosynthesis
- Purine metabolism
- Starch and sucrose metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.6.1.-
Use Curated BLAST to search for 3.6.1.- or 3.6.1.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (186 amino acids)
>JDDGAC_20705 ADP compounds hydrolase NudE (Escherichia coli ECRC98) MSKSLQKPTILNVETVARSRLFTVESVDLEFSNGVRRVYERMRPTNREAVMIVPIVDDHL ILIREYAVGTESYELGFSKGLIDPGESVFEAANRELKEEVGFGANDLTFLKKLSMAPSYF SSKMNIVVAQDLYPESLEGDEPEPLPQVRWPLAHMMDLLEDPDFNEARNVSALFLVREWL KGQGRV