Protein Info for JDDGAC_11500 in Escherichia coli ECRC98

Name: ylbF
Annotation: Uncharacterized protein YlbF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF11392: DUF2877" amino acids 158 to 263 (106 residues), 100.1 bits, see alignment E=5.5e-33

Best Hits

Swiss-Prot: 100% identical to YLBF_ECO57: Uncharacterized protein YlbF (ylbF) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b0520)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>JDDGAC_11500 Uncharacterized protein YlbF (Escherichia coli ECRC98)
MTIIHPLLASSSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQGSGFGPGGWVLRRAQ
FDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAHPQPLAAAWMQRAEETG
LFGPLALAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGPGLTPSHDDTLSGMLLAA
WYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFASPLLHFVHALSCPKRTAV
AIDSLLALGHTSGADTLLGFWLGQQLLQGKP