Protein Info for JDDGAC_05670 in Escherichia coli ECRC98

Name: gp36
Annotation: Bacteriophage Mu, Gp36

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 60 to 78 (19 residues), see Phobius details PF07030: Phage_Mu_Gp36" amino acids 3 to 125 (123 residues), 122 bits, see alignment E=8.4e-40

Best Hits

Swiss-Prot: 41% identical to VG36_HAEIN: Mu-like prophage FluMu protein gp36 (HI_1508) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to ecs:ECs4976)

Predicted SEED Role

"Mu-like prophage protein GP36"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>JDDGAC_05670 Bacteriophage Mu, Gp36 (Escherichia coli ECRC98)
MNYATETDMRARYREDLLRPLLAVPRSDEPDTRKLNRALTDASALIDSYLSARYTLPLEV
IPAVLVQHCCAIAFYYLCDQRASDQARDRYREALAWLKDVMNGNVPVGVDTNGAAPESGD
LPQVQSDAAVFGRNQKGFI