Protein Info for JDDGAC_03590 in Escherichia coli ECRC98

Name: marR
Annotation: multiple antibiotic resistance transcriptional regulator MarR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF01047: MarR" amino acids 38 to 96 (59 residues), 65.9 bits, see alignment E=3.6e-22 PF12802: MarR_2" amino acids 55 to 94 (40 residues), 31.1 bits, see alignment E=3.3e-11

Best Hits

Swiss-Prot: 98% identical to MARR_ECOLI: Multiple antibiotic resistance protein MarR (marR) from Escherichia coli (strain K12)

KEGG orthology group: K03712, MarR family transcriptional regulator (inferred from 99% identity to ecv:APECO1_648)

Predicted SEED Role

"Multiple antibiotic resistance protein MarR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>JDDGAC_03590 multiple antibiotic resistance transcriptional regulator MarR (Escherichia coli ECRC98)
VKSTSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVEL
KKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTSGAAICEQCHQLVGQDLH
QELTKNLTADEVATLEHLLKKVLP