Protein Info for IAI46_25115 in Serratia liquefaciens MT49

Annotation: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02527: GidB
  • amino acids 20 to 201 (182 residues), 210.5 bits, E=1.3e-66
• TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG
  • amino acids 26 to 204 (179 residues), 193.6 bits, E=1.2e-61
• PF13847: Methyltransf_31
  • amino acids 66 to 145 (80 residues), 30 bits, E=4.2e-11

Best Hits

Swiss-Prot: 97% identical to RSMG_SERP5: Ribosomal RNA small subunit methyltransferase G (rsmG) from Serratia proteamaculans (strain 568)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 97% identity to spe:Spro_4909)

MetaCyc: 78% identical to 16S rRNA m7G527 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11578 [EC: 2.1.1.170]

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Protein Sequence (206 amino acids)

>IAI46_25115 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (Serratia liquefaciens MT49)
MQKKLDSLLTAAGIALPDQQKQQLLGYVGMLDKWNKAYNLTSVRDPQQMLVRHILDSIVV
NPHLQGSRFIDVGTGPGLPGIPLAIVRPDSHFTLLDSLGKRVRFLRQVQHELGLTNIEPV
QSRVEEFPAEPPFDGVISRAFASLQDMLSWCHHLPAKGQGRFYALKGVRPDEELTQLPEG
IELESVVRLQVPELEGERHLVILKAN