Protein Info for IAI46_22245 in Serratia liquefaciens MT49

Annotation: EnvZ/OmpR regulon moderator MzrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13721: SecD-TM1" amino acids 3 to 102 (100 residues), 71.4 bits, see alignment E=3.9e-24

Best Hits

Swiss-Prot: 98% identical to MZRA_SERP5: Modulator protein MzrA (mzrA) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 97% identity to srr:SerAS9_4431)

Predicted SEED Role

"Uncharacterized protein YqjB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>IAI46_22245 EnvZ/OmpR regulon moderator MzrA (Serratia liquefaciens MT49)
MIKRPRWQYVLLIALALLALATLLVPCMVRTESELRIRAGQQGLSLPDGFYVYQRLDQRG
IRIKSITPEGDGLVIRLDSPEQQLLAREALQTILPPGYIIALSESPVPTHWVREFARSPL
NLG