Protein Info for IAI46_21980 in Serratia liquefaciens MT49

Annotation: DUF1190 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF06693: DUF1190" amino acids 42 to 206 (165 residues), 190.9 bits, see alignment E=9.7e-61

Best Hits

Swiss-Prot: 96% identical to Y4274_SERP5: UPF0441 protein Spro_4274 (Spro_4274) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 96% identity to spe:Spro_4274)

Predicted SEED Role

"UPF0441 protein ygiB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>IAI46_21980 DUF1190 family protein (Serratia liquefaciens MT49)
MKRTKNINQETFRKSWRNYRVAPVALAISAVFMLAGCEKSDETVSMYQNADDCSRNNPSM
SEQCTTAYNNALKEAEKTAPKYATREDCVAEFGEAQCTQAPAPAQAGMAAESQSSGSFWM
PLMAGYMMGRMMGGSGFAQQPLFTSKNAASPANGKFVDASGKSYGPATAGGRTMTVPKTA
MAPKPAVTNTVTRGGFGESVAKQTSMQRSSATSNSSSRSMGG